Photo coming soon
LL37
Shipping and payment
Chemistry & specifications
Reference data from public databases. For research use only.
| CAS Number | 154947-66-7 |
|---|---|
| Molecular Formula | C205H340N60O53 |
| Molecular Weight | 4493 g/mol |
| Residue Count | 37 |
| Sequence (1-letter) | [LL-37, 37 aa] |
| PubChem CID | 16198951 → |
Peer-reviewed research
Every research claim on this page traces to one of the 4 publications below.
- LL-37: Cathelicidin-related antimicrobial peptide with pleiotropic activityPharmacol Rep (2016)View publication →
- Cathelicidin LL-37: a multitask antimicrobial peptideArch Immunol Ther Exp (Warsz) (2010)View publication →
- The human cathelicidin LL-37--A pore-forming antibacterial peptide and host-cell modulatorBiochim Biophys Acta (2016)View publication →
- Design of Antimicrobial Peptides: Progress Made with Human Cathelicidin LL-37Adv Exp Med Biol (2019)View publication →