Summer SaleEverything is 25% off right now — no code needed.
← Back to shop CCpeptides CC Peptides
Tesamorelin research vials, CC Peptides Photo coming soon

Tesamorelin

Also known asTH9507Egrifta (brand)GHRH(1-44) analogue
99%+ purity, HPLC verified
$52.89 $70.52
Summer Sale 25% off — applied automatically
$5.29 per vial · 10 vials · Save $476.01 vs. buying 10 singles

Shipping and payment

Order in the next --:--:-- and it ships today
Ships from California via USPS Priority. Estimated delivery: --. Free shipping on orders $150+. Every order ships with a free vial of CC Water (BAC water).
256-bit SSL secured checkout Shipment protection included Venmo Cash App

Chemistry & specifications

Reference data from public databases. For research use only.

CAS Number218949-48-5
Molecular FormulaC221H366N72O67S
Molecular Weight5136 g/mol
Residue Count44
Sequence (1-letter)YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
PubChem CID16137828 →

Peer-reviewed research

Every research claim on this page traces to one of the 4 publications below.

  1. Falutz J et al.
    Effects of tesamorelin, a growth hormone-releasing factor, in HIV-infected patients with abdominal fat accumulation: a randomized placebo-controlled trial with a safety extension
    J Acquir Immune Defic Syndr (2010)View publication →
  2. Falutz J et al.
    Effects of tesamorelin (TH9507), a growth hormone-releasing factor analog, in human immunodeficiency virus-infected patients with excess abdominal fat: a pooled analysis of two multicenter, double-blind placebo-controlled phase 3 trials with safety extension data
    J Clin Endocrinol Metab (2010)View publication →
  3. Dhillon S
    Tesamorelin: a review of its use in the management of HIV-associated lipodystrophy
    Drugs (2011)View publication →
  4. Wang Y, Tomlinson B
    Tesamorelin, a human growth hormone releasing factor analogue
    Expert Opin Investig Drugs (2009)View publication →
Research use only – legal notice

For Research Use Only. Not for use in diagnostic procedures.

All products sold by CC Peptides (Central Coast Peptides) are supplied strictly for in-vitro laboratory research and further-manufacturing use only. They are not drugs, medical devices, cosmetics, food, dietary supplements, or household chemicals, and have not been evaluated or approved by the U.S. Food and Drug Administration (FDA).

Products are not intended for, and shall not be used for, human or animal consumption, ingestion, injection, inhalation, topical application, or any therapeutic, diagnostic, prophylactic, cosmetic, or clinical purpose. They are not intended to diagnose, treat, cure, or prevent any disease or condition.

By purchasing, the buyer certifies that they are a qualified researcher or licensed professional acquiring these materials solely for legitimate scientific research or analytical purposes, that they are at least 18 years of age and of legal age to contract in their jurisdiction (including California), and that they will handle, store, use, and dispose of the materials in accordance with all applicable federal, state, and local laws and with standard laboratory safety practices.

To the fullest extent permitted by law, the buyer assumes all risk and responsibility associated with the receipt, possession, handling, and use of these products, and releases, indemnifies, and holds harmless CC Peptides, its owners, officers, employees, and affiliates from any and all claims, damages, liabilities, or losses arising out of misuse, off-label use, or use in violation of these terms. Products are sold “AS IS” with no warranties, express or implied.

Questions about compliance or documentation? Contact us at Support@centralcoastpeptides.com or (805) 259-2514.