CC Peptides ← All research peptides

HomeResearch Peptides › TB500 (Thymosin B4 Acetate)

Research Background

TB500 (Thymosin B4 Acetate) research

Reference summary, chemistry, and peer-reviewed literature on TB500 (Thymosin B4 Acetate) (CAS n.a.). Provided for laboratory researchers; not for human or veterinary use.

Also known as: TB-500, thymosin beta-4 acetate, TMSB4X gene product (endogenous form)

For laboratory research use only. This page summarizes public scientific literature. It is not medical advice and does not describe or endorse human, clinical, or veterinary use.

Chemistry & identity

CAS Numbern.a.
Molecular FormulaC212H350N56O78S
Molecular Weight4963 g/mol
Residue Count43
PubChem CID178271053

Peptide sequence

SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

Research context

PubChem CID 178271053 = "Thymosin beta-4 Acetate"; no CAS on that record (thymosin beta-4 free peptide is CAS 77642-24-1 per DrugBank DB12003). Sequence transcribed from the full three-letter sequence given on PubChem CID 45382195 (Ac-Ser-Asp-Lys-...-Ser-OH), N-terminally acetylated, 43 residues. Note: research-market "TB-500" is often instead the 7-mer fragment Ac-LKKTETQ (PubChem CID 62707662, CAS 885340-08-9); this product is labelled as thymosin beta-4 acetate.

Selected research references

Published peer-reviewed literature on TB500 (Thymosin B4 Acetate). Provided for research-context purposes only; CC Peptides does not make claims about outcomes in humans.

TB500 (Thymosin B4 Acetate) for laboratory research

CC Peptides supplies TB500 (Thymosin B4 Acetate) as a lyophilized reference material with a third-party COA. Ships from California.

View product page →