Chemistry & identity
| CAS Number | n.a. |
|---|---|
| Molecular Formula | C212H350N56O78S |
| Molecular Weight | 4963 g/mol |
| Residue Count | 43 |
| PubChem CID | 178271053 |
Peptide sequence
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Research context
PubChem CID 178271053 = "Thymosin beta-4 Acetate"; no CAS on that record (thymosin beta-4 free peptide is CAS 77642-24-1 per DrugBank DB12003). Sequence transcribed from the full three-letter sequence given on PubChem CID 45382195 (Ac-Ser-Asp-Lys-...-Ser-OH), N-terminally acetylated, 43 residues. Note: research-market "TB-500" is often instead the 7-mer fragment Ac-LKKTETQ (PubChem CID 62707662, CAS 885340-08-9); this product is labelled as thymosin beta-4 acetate.
Selected research references
Published peer-reviewed literature on TB500 (Thymosin B4 Acetate). Provided for research-context purposes only; CC Peptides does not make claims about outcomes in humans.
- Thymosin β4: a multi-functional regenerative peptide. Basic properties and clinical applications
- beta-Thymosins
- Animal studies with thymosin beta, a multifunctional tissue repair and regeneration peptide
- Thymosin beta 4 and a synthetic peptide containing its actin-binding domain promote dermal wound repair in db/db diabetic mice and in aged mice
TB500 (Thymosin B4 Acetate) for laboratory research
CC Peptides supplies TB500 (Thymosin B4 Acetate) as a lyophilized reference material with a third-party COA. Ships from California.
View product page →