CC Peptides ← All research peptides

Home › Research Peptides › LL37 (Cathelicidin LL-37)

Research Background

LL37 (Cathelicidin LL-37) research

Reference summary, chemistry, and peer-reviewed literature on LL37 (Cathelicidin LL-37) (CAS 154947-66-7). Provided for laboratory researchers; not for human or veterinary use.

Also known as: LL-37, CAP-18, cathelicidin antimicrobial peptide (CAMP) 134-170, ropocamptide, FALL-39 fragment

For laboratory research use only. This page summarizes public scientific literature. It is not medical advice and does not describe or endorse human, clinical, or veterinary use.

Chemistry & identity

CAS Number154947-66-7
Molecular FormulaC205H340N60O53
Molecular Weight4493 g/mol
Residue Count37
PubChem CID16198951

Peptide sequence

[LL-37, 37 aa]

Research context

UniProt P49913 (CAMP_HUMAN) annotates LL-37 as residues 134-170 (37 aa) of pro-cathelicidin with measured mass 4492.9 Da.

Selected research references

Published peer-reviewed literature on LL37 (Cathelicidin LL-37). Provided for research-context purposes only; CC Peptides does not make claims about outcomes in humans.

LL37 (Cathelicidin LL-37) for laboratory research

CC Peptides supplies LL37 (Cathelicidin LL-37) as a lyophilized reference material with a third-party COA. Ships from California.

View product page →

For laboratory research use only. Not for human or veterinary use. · Quality standards · Affiliate terms