For laboratory research use only. This page summarizes public scientific literature. It is not medical advice and does not describe or endorse human, clinical, or veterinary use.
Chemistry & identity
| CAS Number | 218949-48-5 |
|---|---|
| Molecular Formula | C221H366N72O67S |
| Molecular Weight | 5136 g/mol |
| Residue Count | 44 |
| PubChem CID | 16137828 |
Peptide sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Research context
N-terminus is trans-3-hexenoyl-modified (DrugBank synonym "N-[(3E)-1-oxo-3-hexenyl]Somatoliberin").
Selected research references
Published peer-reviewed literature on Tesamorelin. Provided for research-context purposes only; CC Peptides does not make claims about outcomes in humans.
- Effects of tesamorelin, a growth hormone-releasing factor, in HIV-infected patients with abdominal fat accumulation: a randomized placebo-controlled trial with a safety extension
- Effects of tesamorelin (TH9507), a growth hormone-releasing factor analog, in human immunodeficiency virus-infected patients with excess abdominal fat: a pooled analysis of two multicenter, double-blind placebo-controlled phase 3 trials with safety extension data
- Tesamorelin: a review of its use in the management of HIV-associated lipodystrophy
- Tesamorelin, a human growth hormone releasing factor analogue
Tesamorelin for laboratory research
CC Peptides supplies Tesamorelin as a lyophilized reference material with a third-party COA. Ships from California.
View product page →