October Holiday Sale Everything is 40% off right now · no code needed · same-day shipping on in-stock orders.
← Back to shop Central Coast Peptides Central Coast Peptides
hCG 5000 IU research vials, Central Coast Peptides Photo coming soon

hCG

Also known aschorionic gonadotropin (human)
99%+ purity, HPLC verified
$83.40 $129.70
40% off sitewide — October Holiday Sale, applied automatically
$41.70 per vial · 2 vials · Save $37.52 vs. buying 2 singles
Choose a pack

Shipping and payment

In stock — dispatched the same day when you order Monday–Friday before 3:00 PM Pacific, then up to 3 business days in transit. Order after 3:00 PM Pacific, on a weekend, or on a US federal holiday and it is dispatched the next business day — never later than 2 business days after your order. Dispatch is our handling time, not the delivery date; transit is counted separately after it. We dispatch Monday–Friday only, carriers do not deliver on Sundays, and weekends and US federal holidays are not counted — full details in the shipping policy.
Ships from California via UPS 2nd Day Air — carrier transit is added after our handling time. Free shipping on orders $200+. Orders of $175+ include a free vial of bacteriostatic water. Shipping & storage guide
256-bit SSL secured checkout Shipment protection included Venmo Cash App

Chemistry & specifications

Reference data from public databases. For research use only.

CAS Number9002-61-3
Molecular FormulaNot available
Molecular WeightNot available
Residue CountNot available
Sequence (1-letter)alpha chain: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS | beta chain: SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
PubChem CIDNot available

Common questions

What pack sizes and strengths are available for hCG?

hCG is offered as a 2-vial kit, a single vial, or a 10-vial box. Available strengths: 5000 IU and 10000 IU per vial. Every vial in a kit or box is the strength you select. The price per vial for each pack is shown under the price.

How quickly does hCG ship?

hCG in 5000 IU ships the same day when you order Monday to Friday before 3:00 PM Pacific. Orders after the cutoff, on weekends, or on US federal holidays ship the next business day, and never later than 2 business days after the order. The 10000 IU strength is prepared to order and dispatched within 7 business days. Carrier transit then takes up to 3 business days within the contiguous United States. Standard shipping is a $18.99 flat rate and free on orders over $200.

Shipping and storage guide →

How should hCG be stored?

Lyophilized (freeze-dried) vials tolerate normal shipping at room temperature. On arrival, keep them sealed, dry and away from light: a refrigerator at about 4 °C for the short term, or −20 °C or colder for long-term storage. Let a cold vial reach room temperature before opening it so moisture does not condense on the powder.

How to store lyophilized peptides →

How do I work out the concentration after reconstitution?

Concentration in mg/mL equals the vial amount in mg divided by the mL of solvent added. Our free reconstitution calculator also shows the mg held at each 0.1 mL mark.

Reconstitution calculator →

Is hCG for human use?

No. hCG is sold strictly for laboratory research use. It is not a drug, food, dietary supplement, or cosmetic, has not been evaluated by the FDA, and is not for human or veterinary use. Purchasers must be 21 or older.

Related research compounds

Research background

Chemistry, identity, and a summary of the peer-reviewed literature on hCG (Human Chorionic Gonadotropin).

Read the hCG (Human Chorionic Gonadotropin) research background → Reconstitution calculator →

Peer-reviewed research

Every research claim on this page traces to one of the 3 publications below.

  1. Herkert D et al.
    Human Chorionic Gonadotropin-A Review of the Literature
    Obstet Gynecol Surv (2022)View publication →
  2. d'Hauterive SP et al.
    Human Chorionic Gonadotropin and Early Embryogenesis: Review
    Int J Mol Sci (2022)View publication →
  3. Schüler-Toprak S, Treeck O, Ortmann O
    Human Chorionic Gonadotropin and Breast Cancer
    Int J Mol Sci (2017)View publication →
FAQ
Are your peptides third-party tested for purity, and where is the testing performed?

Yes. Every product offered by Central Coast Peptides is independently analyzed prior to release by a California-based ISO/IEC 17025-accredited analytical chemistry laboratory — an independent contract testing facility that operates outside our supply chain and reports directly to us on each lot.

Testing is conducted using industry-standard analytical methods, including:

  • High-Performance Liquid Chromatography (HPLC) — quantifies the target compound and identifies impurities by separation.
  • Liquid Chromatography–Mass Spectrometry (LC-MS) — confirms molecular identity and molecular weight against the reference standard.
  • Residual solvent, moisture, and endotoxin screening where applicable to the compound class.

Lots that fail to meet our internal identity and purity specifications are rejected and are not offered on this site. Lot-specific results are documented on the Certificate of Analysis (COA) for that lot.

A Certificate of Analysis (COA) is available to verified researchers upon written request at Support@centralcoastpeptides.com. All products are supplied strictly for in-vitro laboratory research and are not intended for human or animal consumption, diagnostic use, therapeutic use, or any clinical application.

What’s it like ordering from Central Coast Peptides?

Browse the catalog, pick your vial or kit, and check out. Orders are confirmed within minutes. In-stock items ordered Monday–Friday before 3:00 PM Pacific are dispatched the same day; items badged “Ships in 7 Business Days” go out within 7. Then up to 3 business days in transit. Questions? A person on California’s Central Coast replies to Support@centralcoastpeptides.com within one business day, usually sooner.

How fast is shipping and support?

Items badged “Ships Same Day” are dispatched the same day when you order Monday–Friday before 3:00 PM Pacific; after 3:00 PM Pacific, on a weekend, or on a US federal holiday they go out the next business day, and never later than 2 business days. Items badged “Ships in 7 Business Days” are dispatched within 7. That is our handling time, not the delivery date. Carrier transit is counted separately after dispatch and takes up to 3 business days. We dispatch Monday–Friday only, carriers deliver Monday–Saturday and never on Sunday, and weekends and US federal holidays are not counted in either window.

Email replies within one business day, phone answered during business hours — both go to our team on California’s Central Coast, not an offshore queue.

How fast is local delivery?

Local delivery is a $10.50 flat rate (free on orders over $200) covering San Luis Obispo County and the Santa Maria area. It has two steps, and both are ours: we pack your order, then we bring it to you on our next local delivery run — a separate day, with no carrier involved.

If your order contains only Ships Same Day items, ordering Monday–Friday before 3:00 PM Pacific means we pack it that day and deliver it the next business day. After 3:00 PM Pacific, on a weekend, or on a US federal holiday we pack it the next business day and deliver it the day after that. Either way it arrives within 2 business days of when you placed it.

To be clear: ordering before 3:00 PM does not mean same-day delivery. The cutoff sets the day we pack your order, not the day it arrives. Your receipt shows both dates side by side.

If your order contains any Ships in 7 Business Days item, the entire local order is packed and delivered together within 7 business days, unless we separately arrange a split delivery with you. Local delivery runs Monday–Friday only, and weekends and US federal holidays are not counted.

My order has both same-day and 7 business day items. When does it ship?

An item labeled Ships Same Day on its own is dispatched the same day when ordered Monday–Friday before 3:00 PM Pacific. But if your order contains any item labeled Ships in 7 Business Days, the entire order is dispatched together within 7 business days of the order date — the same-day cutoff does not apply to it — unless we separately arrange a split shipment with you.

“Ships within” is our processing and dispatch time — it is not the delivery date. Carrier transit follows dispatch and takes up to 3 business days, counted separately. We dispatch Monday–Friday only, carriers do not deliver on Sundays, and weekends and US federal holidays are not counted in either window. Full details are in the Shipping Policy.

Can I return an order or get a refund?

No. All sales are final. We do not accept returns, exchanges, or refunds — including for a change of mind, an ordering mistake, or an unused product — except where required by applicable law. If you received the wrong item or an item damaged in transit, contact us within 30 days of delivery and we will make it right. See our Return & Refund Policy and Terms of Sale.

What if my item arrives damaged or I received the wrong item?

Contact us within 30 days of delivery at Support@centralcoastpeptides.com or (805) 259-2514 with your order number, clear photos of the item and packaging, and a short description of the problem. Please do not ship anything back to us without our authorization. We will review the report and provide any remedy required by applicable law.

Contact

Located on California’s Central Coast, in San Luis Obispo County.

(805) 259-2514
Support@centralcoastpeptides.com
Research use only – legal notice

For Research Use Only. Not for use in diagnostic procedures.

All products sold by Central Coast Peptides are supplied strictly for in-vitro laboratory research and further-manufacturing use only. They are not drugs, medical devices, cosmetics, food, dietary supplements, or household chemicals, and have not been evaluated or approved by the U.S. Food and Drug Administration (FDA).

Products are not intended for, and shall not be used for, human or animal consumption, ingestion, injection, inhalation, topical application, or any therapeutic, diagnostic, prophylactic, cosmetic, or clinical purpose. They are not intended to diagnose, treat, cure, or prevent any disease or condition.

By purchasing, the buyer certifies that they are a qualified researcher or licensed professional acquiring these materials solely for legitimate scientific research or analytical purposes, that they are at least 21 years of age and of legal age to contract in their jurisdiction (including California), and that they will handle, store, use, and dispose of the materials in accordance with all applicable federal, state, and local laws and with standard laboratory safety practices.

To the fullest extent permitted by law, the buyer assumes all risk and responsibility associated with the receipt, possession, handling, and use of these products, and releases, indemnifies, and holds harmless Central Coast Peptides, its owners, officers, employees, and affiliates from any and all claims, damages, liabilities, or losses arising out of misuse, off-label use, or use in violation of these terms. Products are sold “AS IS” with no warranties, express or implied.

Questions about compliance or documentation? Contact us at Support@centralcoastpeptides.com or (805) 259-2514.