For laboratory research use only. This page summarizes public scientific literature. It is not medical advice and does not describe or endorse human, clinical, or veterinary use.
Chemistry & identity
| CAS Number | 9002-61-3 |
|---|---|
| Molecular Formula | n.a. |
| Molecular Weight | n.a. g/mol |
| PubChem CID | n.a. |
Peptide sequence
alpha chain: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS | beta chain: SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
Research context
hCG is a glycosylated heterodimeric glycoprotein hormone, so it has no single molecular formula or MW; DrugBank DB09126 lists "Not Available" for both. Both chain sequences are quoted verbatim from DrugBank DB09126; residueCount left null because the molecule is a two-chain glycoprotein.
Selected research references
Published peer-reviewed literature on HCG (Human Chorionic Gonadotropin). Provided for research-context purposes only; CC Peptides does not make claims about outcomes in humans.
HCG (Human Chorionic Gonadotropin) for laboratory research
CC Peptides supplies HCG (Human Chorionic Gonadotropin) as a lyophilized reference material with a third-party COA. Ships from California.
View product page →